
Proxofim – [Gezuiverd van TFA] FOXO4-Dri / FOXO4 D-Retro-Inverso(DRI) peptide – Nederland/Belgie. CONTACT US IF PRODUCT IS OUT OF STOCK.


SKU: N/A Category:

Foxo4-dri / Proxofim Productomschrijving


We kunnen u bij urgente bestellingen direct helpen.


Onze producten zijn uitsluitend voor laboratoriumdoeleinden.
In tegenstelling tot Chinese vendors zuiveren wij onze producten van schadelijke TFA-zouten. Ons product is gegarandeerd steriel en vrij van synthesebijproducten.


Foxo4-dri, ook wel bekend als Proxofim, is een stof waarvan een senolytische en ouderdom-omkerende werking is aangetoond in Nederlandse muizenstudies. Breakthrough Biolabs biedt nu kwalitatief hoogwaardige Foxo4-dri voor researchdoeleinden aan het grote publiek. Omdat wij geloven dat iedereen toegang zou moeten hebben tot hoogwaardige, baanbrekende onderzoeksstoffen hebben we Foxo4-dri oftewel Proxofim beschikbaar gesteld voor de laagste prijs online.


Een van de hoofdoorzaken van veroudering is de ophoping van senescente cellen. Dit zijn oude cellen, een soort “zombiecellen”, die zo beschadigd zijn dat ze niet meer in apoptose, of geprogrammeerde celdood, kunnen treden. Dit zorgt ervoor dat ze schadelijke signaalstoffen in het lichaam sturen en niet kunnen worden opgeruimd. Een senolyticum is een middel wat deze cellen alsnog opruimt. Foxo4-dri is een senolyticum, en werkt als volgt: Het p53-eiwit breekt weg van FOXO4 wanneer Foxo4-dri geïntroduceerd wordt in senscente cellen. Door dit effect treedt de cel in apoptose en wordt de cel opgeruimd. Dit zorgt voor een verjongde omgeving voor andere, gezonde cellen: De normale cellen hebben meer ruimte en worden niet beschadigd door signaalstoffen van de senescente cellen, waardoor de gezondheid vooruit gaat.


Het Foxo4-gen bevindt zich in de celkern, en het p53-eiwit werkt op het mitochondriale niveau, twee verschillende locaties binnenin de cel. Breakthrough Biolabs heeft een manier om p53 en FOXO4 van elkaar los te maken, zodat het p53 eiwit zijn werk kan doen. Dit zorgt ervoor dat de senescente in apoptose kan treden en opgeruimd wordt. Om dit te realiseren is een andere versie van FOXO4 ontwikkeld. Dit nieuwe peptide is Foxo4-dri, die zich als FOXO4 gedraagt vanuit een biochemisch standpunt. Echter kan Foxo4-dri zich ook buiten de celkern bevinden, waardoor het zijn werk kan doen.


Foxo4-dri heeft dus ongelovelijke implicaties. In dierenstudies kwam niet enkel de cellulaire functie terug, maar trad ook systemische verandering in het organisme op. Dieren met orgaanschade herstelden. Het dier kreeg meer energie, begon zich meer fysiek te bewegen en de algehele gezondheid ging vooruit.

FOXO4 D-Retro-Inverso(DRI) peptide feiten:

MS/HPLC rapport


1 buis









Moleculaire formule


Moleculair gewicht


Aanvullende informatie

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in ‘Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis” in response to “Chemotoxicity and Aging” by Baar et al. The peptide has the following the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP. The amino acids in said sequence are D-amino acid residues. The Proxofim peptide selectively induces apoptosis of senescent cells. Because of this, it reverses effects of chemotoxicity and aging in mice. Het peptide is ge-reconstituteerd.


Ideally FOXO4 D-Retro-Inverso(DRI) peptide should be stored in a freezer at or below -9C. FOXO4 D-Retro-Inverso(DRI) peptide should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides


De peptides zijn niet bedoeld voor consumptie en worden aangeboden als onderzoeksstof. U bent volledig verantwoordelijk voor de compliance aan uw lokale wetgeving.


Baar, Marjolein P. et al. Targeted Apoptosis Of Senescent Cells Restores Tissue Homeostasis In Response To Chemotoxicity And Aging. Cell 169.1 (2017): 132-147.e16. Web. 25 Mar. 2017.


5mg, 10mg, 20mg, 50mg,100mg


5mg, 10mg, 20mg, 50mg, 100mg, Custom/wholesale


There are no reviews yet.

Be the first to review “Proxofim – [Gezuiverd van TFA] FOXO4-Dri / FOXO4 D-Retro-Inverso(DRI) peptide – Nederland/Belgie. CONTACT US IF PRODUCT IS OUT OF STOCK.”

Your email address will not be published. Required fields are marked *