Foxo4-dri / Proxofim Product Description

CONTACT US IF PRODUCT IS OUT OF STOCK.

We can fulfill your order directly in case of urgent inquiries.

 

Our products are intended for laboratory research.

In contrast to Chinese alternatives, we purify our products of synthesis byproducts such as TFA salts in our own USA-based partner labs. We periodically verify our products by third parties.

Foxo4-dri, also known as Proxofim, is a research compound which has been shown to be the world’s first senolytic peptide in Dutch mouse studies. At Breakthrough Biolabs, we offer high quality Foxo4-dri for research purposes. Because we believe that everyone should have to high quality, cutting-edge research compounds, we have made Foxo4-dri (also known as Proxofim) available for the lowest price available online.

Biochemistry

FOXO4 lives in the nucleus of the cell and p53 does its work at the mitochondrial level — two very different sites in the inside of a cell. At Breakthrough Labs we needed to find a way to get P53 and FOXO4 separated from one another so that p53 could do its work and eliminate the senescent cell from the inside. To do this another version of FOXO4 was created that had a Trojan horse effect ( it acted like FOXO4 from a chemical standpoint) . This molecule looked like FOXO4 to the cell, and it acted like it too, but this peptide called FOXO4-dri, didn’t only live in the nucleus — it could exist at any place inside the cell.

Senolytic

The p53 breaks away from FOXO4 when FOXO4-dri is introduced into the senescent cells. Because of this effect the cell can do it’s work and the cell can undergo apoptosis — it can finally commit suicide. Therefore, it does not hang around and signal harmful chemical messages to the other cells. This is what occurs in younger subjects, where this mechanism is at peak. Therefore, a senolytic virtually recreates a younger cellular environment. Once senescent cells are killed off, past a threshold level of them being toxic, healthy cells are allowed to flourish.

Rejuvenation

Thus, this compound has amazing implications. In animal studies using this substance, not only cellular function returned but systemic change occurred as well. Animals with organ damage, saw these traits reversed. Energy returned and physical activity increased. Similar results have been profiled in small-scale, preclinical human studies.

FOXO4 D-Retro-Inverso(DRI) peptide

MS/HPLC Reports	MS Report HPLC Report
Quantity/Unit	1 Vial
Sequence	H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Three letter code	H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
Length	46
Peptide Purity (%)	>95.5%
Molecular Formula	C228H388N86O64
Molecular Weight	5358.05
Additional Information	FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in ‘Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis” in response to “Chemotoxicity and Aging” by Baar et al. The peptide has the following the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP. The amino acids in said sequence are D-amino acid residues. The Proxofim peptide selectively induces apoptosis of senescent cells. Because of this, it reverses effects of chemotoxicity and aging in mice. The peptide is reconstituted.
Storage Guidelines	Ideally FOXO4 D-Retro-Inverso(DRI) peptide should be stored in a freezer at or below -9C. FOXO4 D-Retro-Inverso(DRI) peptide should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
Terms	Please do not use the peptide for human consumption. It is your sole responsibility to comply with the laws in your country.
References	Baar, Marjolein P. et al. Targeted Apoptosis Of Senescent Cells Restores Tissue Homeostasis In Response To Chemotoxicity And Aging. Cell 169.1 (2017): 132-147.e16. Web. 25 Mar. 2017.

Quantity

5mg, 10mg, 20mg, 50mg,100mg