
FOXO4 D-Retro-Inverso(DRI) peptide


SKU: N/A Category:

Our products are intended for laboratory research only

FOXO4 lives in the nucleus of the cell and p53 does its work at the mitochondrial level — two very different sites in the inside of a cell. At Breakthrough Labs we needed to find a way to get P53 and FOXO4 separated from one another so that p53 could do its work and eliminate the senescent cell from the inside. To do this another version of FOXO4 was created that had a Trojan horse effect ( it acted like FOXO4 from a chemical standpoint) . This molecule looked like FOXO4 to the cell, and it acted like it too, but this peptide called FOXO4-dri, didn’t only live in the nucleus — it could exist at any place inside the cell.

The p53 breaks away from FOXO4 when FOXO4-DRI is introduced into the senescent cells. Now the compound can do it’s work and the cell would undergo apoptosis — it would can finally commit suicide, and not hang around to signal bad chemical messages to the other cells. This is what occurs in younger subjects, where this mechanism is at peak. It virtually recreates a younger cellular environment. Once senescent cells are killed off, past a threshold level of them being toxic, healthy cells are allowed to flourish.

This compound has amazing implications. In animal studies using this substance, not only cellular function returned but systemic change occurred as well. Animals with organ damage, saw these traits reversed. Energy returned and physical activity increased. Similar results have been profiled in small-scale, preclinical human studies.

FOXO4 D-Retro-Inverso(DRI) peptide

MS/HPLC Reports


1 Vial



Three letter code




Peptide Purity (%)


Molecular Formula


Molecular Weight


Additional Information

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in ‘Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging’ by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Storage Guidelines

Ideally FOXO4 D-Retro-Inverso(DRI) peptide should be stored in a freezer at or below -9C. FOXO4 D-Retro-Inverso(DRI) peptide should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides


Please do not use the peptide for human consumption.


Baar, Marjolein P. et al. Targeted Apoptosis Of Senescent Cells Restores Tissue Homeostasis In Response To Chemotoxicity And Aging. Cell 169.1 (2017): 132-147.e16. Web. 25 Mar. 2017.


5mg, 10mg, 20mg, 50mg,100mg


5mg, 10mg, 20mg, 50mg, 100mg, Custom/wholesale


There are no reviews yet.

Be the first to review “FOXO4 D-Retro-Inverso(DRI) peptide”

Your email address will not be published. Required fields are marked *